Companies / Finland
Järvenpään Taksiammattilaiset Oy: company profile
Järvenpään Taksiammattilaiset Oy is a limited company (Oy) in Finland, registry number 3179802-7, status active. Järvenpään Taksiammattilaiset Oy is named as winner on 3 public contract award notices between 2025-01-20 and 2025-02-03, from buyers in Finland. Source: Arcadium Data, data as of .
Järvenpään Taksiammattilaiset Oy works in land transport and pipelines (NACE 49.33), was registered on 2021-02-01 and has its registered office in JÄRVENPÄÄ.
Registry
| Item | Value |
|---|---|
| Register | Finnish Patent and Registration Office (PRH) business information system |
| Registry number | 3179802-7 |
| Registered name | Järvenpään Taksiammattilaiset Oy |
| Legal form | limited company (Oy) |
| Status | active |
| Registered on | 2021-02-01 |
| Place | JÄRVENPÄÄ, Finland |
| Sector (NACE) | Land transport and pipelines (49.33) |
From the public register (entry); the website was matched to the registry entry by the register's own website field. Companies only: sole traders and partnerships of persons are not listed.
Public contracts
Järvenpään Taksiammattilaiset Oy is named as winner on 3 public contract award notices between 2025-01-20 and 2025-02-03, from buyers in Finland.
Track this company
Get a free weekly email when Järvenpään Taksiammattilaiset Oy opens or closes jobs or something else about it changes. Free account, no card; the first month of the weekly digest is free.
More companies
- Same sector: Jousmäki Oy · JS Matkat Oy · Kasilinja Oy · Kuljetus ja maanrakennus Katupojat Oy
- Same place (JÄRVENPÄÄ): Kapina Oy · Kavika Oy · Kierto Ympäristöpalvelut Oy · Suomen LVIS-Huolto Oy
- Also won contracts in the same country: Järvileasing Oy · Jatke Toimitilat Oy · JHM-Kaivin Oy
- Tenders in Finland · All companies
Data for Järvenpään Taksiammattilaiset Oy via API and MCP
API: GET /v1/companies/jarvenpaantaksiammattilaiset.fi returns this profile as JSON.
curl https://api.arcadiumdata.io/v1/companies/jarvenpaantaksiammattilaiset.fiMCP: call company_profile with {"domain": "jarvenpaantaksiammattilaiset.fi"} (Arcadium Data MCP server). Registry ids, open jobs, contracts won and company events are in the same response. Free API key.
Sources: public company registers, public procurement notices (TED and national portals), Arcadium Data matching of websites to registry entries. Company-level facts only; no names of people. Data as of 2026-10-27 (October 2026).
Questions
Is Järvenpään Taksiammattilaiset Oy a registered company?
Järvenpään Taksiammattilaiset Oy is a limited company (Oy) in Finland, registry number 3179802-7, status active.
Has Järvenpään Taksiammattilaiset Oy won public contracts?
Järvenpään Taksiammattilaiset Oy is named as winner on 3 public contract award notices between 2025-01-20 and 2025-02-03, from buyers in Finland.
Cite as: Arcadium Data, "Järvenpään Taksiammattilaiset Oy: company profile", https://arcadiumdata.io/company/jarvenpaantaksiammattilaiset.fi/, data as of 2026-10-27.